(Clicks: 74;website added: Jun 7, 2015, offering)
Australian based server network offering True Cloud Web Hosting for businesses who are serious about their websites.
business web hosting cloud web hosting email hosting domain name registration brisbane melbourne sydney australia homepage centre
homepagecenter.com.au(Clicks: 74;website added: Jun 2, 2015, offering)
Bunnik Tours specialise in holiday packages and small group tours, offering unrivalled value, more inclusions and unique itineraries.
jordanonsale.com.au(Clicks: 74;website added: May 23, 2015, offering)
Mettle Nation Health & Performance & Mettle Nation CrossFit Sydney. Offering a premium fitness experience just minutes from Sydney's CBD.
mnhp.com.au(Clicks: 74;website added: May 21, 2015, offering)
Mr Supps is the ultimate website catering for bodybuilders, fitness enthusiasts and general health offering the largest selection of products to help you achieve your health and physique goals including amino acids, multi vitamins, capsulated products
health training supplements protein bodybuilders fitness enthusiasts general health products physique goals
mrsupps.com.au(Clicks: 74;website added: May 21, 2015, offering)
My Workforce's My Recruitment solution can be used to supplement your existing HR staff or it can be bundled with our other services offering you an entire HR Solution.
managing hr issues entire hr solution employee lifecycle lifecycle partnership reduce recruitment costs recruitment outsourcing
my-recruitment.com.au(Clicks: 74;website added: May 21, 2015, offering)
MyFirstJob aims to halve youth unemployment by 2020 by supporting employers offering entry level jobs and the appointment of a Minister for Youth Employment
my first job syc initiative youth employment youth unemployment prepare for work entry level position job interviews
myfirstjob.com.au(Clicks: 74;website added: May 20, 2015, offering)
MyIFA is a fully independent Financial Advice firm offering financial planning advice about SMSF’s, Retirement Planning, Personal & Business Insurance, Superannuation & Investments.
myindependentfinancialadviser.com.au(Clicks: 74;website added: May 14, 2015, offering)
Pemberton Limes are the leading producer of Bio-Organically grown Tahitian Limes offering international and domestic wholesalers large volumes of Limes.
pembertonlimes.com.au(Clicks: 74;website added: May 11, 2015, offering)
Small business web hosting offering additional business services such as: domain name registrations, email accounts, web services, FrontPage help, online community resources and various small business solutions.
web hosting domain names web site hosting servers
printessentials.com.au(Clicks: 74;website added: May 10, 2015, offering)
PURE Grips is the leading manufacturer of Golf Grips in America, offering superior comfort and exceptional all-weather durability with a simple installation procedure, for a great golfing experience, at a great value.
durable golf grips
puregrips.com.au(Clicks: 74;website added: May 9, 2015, offering)
RAL Photography is offering professional Sydney wedding photography coverage in and around Sydney area, Melbourne, Queensland, Perth. With clients based all over the world, Sydney is home to this Sydney wedding photographer. Expect only the best photos.
ralphotography.com.au(Clicks: 74;website added: May 7, 2015, offering)
☎ 0474 353 682 Restore Rehabilitation is a unique Physiotherapy service offering home based rehabilitation in the North East, East and South Eastern Suburbs of Melbourne
physiotherapy rehabilitation in home physio melbourne
restorerehabilitation.com.au(Clicks: 74;website added: May 4, 2015, offering)
Offering services in Meditation & ITA Energy Medicine. Reconnect with your body, mind & soul... start to experience â€pure†health...
satvahealth.com.au(Clicks: 74;website added: Nov 8, 2013, offering)
Alexanders Lawyers is a dynamic law firm offering individually tailored legal advice focussed on practical business solutions for our clients.
alexanders lawyers stephen alexandrou legal advice business solutions business solutions
alibi.com.au(Clicks: 74;website added: Nov 5, 2013, offering)
Offering stunning Photography and Video services to Geelong and the Surf Coast | Full Focus Video a
fullfocus.com.au(Clicks: 74;website added: Nov 4, 2013, offering)
GraysOnline is an Australian online retail and auction company, offering a huge range of consumer, industrial and commercial goods, direct from manufacturers and distributors.
grayonline.com.au(Clicks: 74;website added: Nov 4, 2013, offering)
Hartleyâs Body Corporate Management is a modern firm offering our clients an efficient, pro-active and professional Body Corporate Management service. We base this on an extensive background in Operational and Administrative Management.
hartleysbodycorporate.com.au(Clicks: 74;website added: Nov 4, 2013, offering)
At Hooper Recruitment we care about our clients requirements & the candidates future. Hooper Recruitment is about offering a range of recruitment solutions and tailoring packages, in consultation with our Clients, to meet their requirements.
executive accounting finance not for profit charity
hooperrecruitment.com.au(Clicks: 74;website added: Nov 3, 2013, offering)
IT Warehouse Marion now a Locally SA Owned Computer Store offering the best price and service on all components, Now SA's NZXT and Gainward distributor.
new computers marion store local local repair support custom built gaming
itwarehouse.com.au(Clicks: 74;website added: Nov 3, 2013, offering)
Locksmith Glebe 0433 999 649 - 24 Hour Emergency Locksmiths Glebe offering a mobile service specialising in rapid response after hour emergency work.
locksmith glebe locksmiths glebe
locksmithglebe.com.au