(Clicks: 71;website added: Oct 31, 2013, offering)
ServePoint is a Melbourne based Web Design, development, hosting and online marketing provider offering affordable web design and development services
servepoint.com.au(Clicks: 71;website added: Oct 28, 2013, offering)
More is a fresh and vibrant cafe/restaurant with an urban feel offering an exciting menu that caters for breakfast,lunch, coffee, cakes and treats
busselton cafe cafe busselton restaurants busselton restuarant busselton restuarant takeaways takeaway corporate catering catering function catering
morecafe.net.au(Clicks: 70;website added: Jul 6, 2015, offering)
International Hotel Management School in Australia offering hospitality and business degrees in hotel, resort, restaurant and event management
bluemountainshotelschool.com.au(Clicks: 70;website added: Jun 30, 2015, offering)
Your church seating expert in Australia! Offering quality and variety in church chairs at competitive rates for all kinds of religious seating arrangements
churchseating.com.au(Clicks: 70;website added: Jun 23, 2015, offering)
Small business web hosting offering additional business services such as: domain name registrations, email accounts, web services, FrontPage help, online community resources and various small business solutions.
web hosting domain names web site hosting servers
discatering.com.au(Clicks: 70;website added: Jun 19, 2015, offering)
Encore Dance Studio is Bundaberg's number 1 dance studio. Offering Jazz, Ballet, Tap, Hip Hop, Contemporary & Musical Theatre for boys and girls.
ballet bundaberg contemporary curd dance encore hip hop jazz musical theatre penny
encoredancestudio.com.au(Clicks: 70;website added: Jun 19, 2015, offering)
We are a specialized consulting company offering policy and management advice about the Australian environment, particularly in relation to natural resource management and protected areas.
enviroanalysis.com.au(Clicks: 70;website added: Jun 12, 2015, offering)
Global Kulture is a new retail offering a diverse range of products to help the convenience market increase it’s profits.
globalkulture.com.au(Clicks: 70;website added: Jun 7, 2015, offering)
CBD bar located in a stylish restored Victorian building in the heart of Sydney. Offering a combination of great pub food, eautiful decor and great service.
hotelcbd.com.au(Clicks: 70;website added: Jun 4, 2015, offering)
Integrity Courier are Western Sydney's leading Courier offering rack and freight services from Penrith to Parramatta
courier penrith courier parramatta courier western sydney
integritycourier.com.au(Clicks: 70;website added: Jun 2, 2015, offering)
Bunnik Tours specialise in holiday packages and small group tours, offering unrivalled value, more inclusions and unique itineraries.
jordanonsale.com.au(Clicks: 70;website added: Jun 1, 2015, offering)
Kentronics formed in 1996 offering the Petroleum Industry an alternative repairer for the electronic modules found in Retail/Commercial Petrol Bowser equipment
service kentronics customer extremely satisfaction industry outcomes mission offer
kentronics.com.au(Clicks: 70;website added: May 20, 2015, offering)
MyIFA is a fully independent Financial Advice firm offering financial planning advice about SMSF’s, Retirement Planning, Personal & Business Insurance, Superannuation & Investments.
myindependentfinancialadviser.com.au(Clicks: 70;website added: May 20, 2015, offering)
Nativespace are well established UK Web Hosts, offering a variety of Web Hosting services.
uk web hosts nativespace
nativespace.com.au(Clicks: 70;website added: May 17, 2015, offering)
An Australian Online Store Offering: A Lifestyle Full Of Fun! Beautiful Home Decor, Jewellery, Clothing and Beauty products. 'Love Life and Life Will Love You Back' - Online Store Powered by Storenvy
all products home decor jewellery clothing clutches
oddsandhems.com.au(Clicks: 70;website added: May 16, 2015, offering)
Our Shopping Australia | A selection of online store retailers throughout Australia offering free shipping nationwide
online shopping australia free shipping
ourshopping.com.au(Clicks: 70;website added: May 15, 2015, offering)
Located in Melbourne, our professional staff are committed to offering the spectrum of reconstructive and cosmetic plastic surgery across 4 clinics.
parksideplasticsurgery.com.au(Clicks: 70;website added: May 8, 2015, offering)
Red Hot Sunglasses is one of Australia's leading online designer sunglasses shops, offering 100% trend driven sunglasses with FREE worldwide delivery.
designer sunglasses sunglasses sunglasses australia
redhotsunglasses.com.au(Clicks: 70;website added: Apr 27, 2015, offering)
Property Management Experts in Newcastle. A boutique business offering personal service and professional results.
stressfreepropertysales.com.au(Clicks: 70;website added: Apr 27, 2015, offering)
Affordable web design ~ Newcastle & Australia wide. Sublime Web Design is a Newcastle based business offering professional websites at affordable prices.
website design web design newcastle australia professional website
sublimewebdesign.com.au